Lineage for d1gzpa2 (1gzp A:4-183)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719354Protein CD1, alpha-1 and alpha-2 domains [54456] (3 species)
    Class I MHC-related
  7. 719361Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (3 PDB entries)
  8. 719363Domain d1gzpa2: 1gzp A:4-183 [70816]
    Other proteins in same PDB: d1gzpa1, d1gzpb_
    complexed with d12, gm2, twt

Details for d1gzpa2

PDB Entry: 1gzp (more details), 2.8 Å

PDB Description: cd1b in complex with gm2 ganglioside
PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOP Domain Sequences for d1gzpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gzpa2 d.19.1.1 (A:4-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
fqgptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdkev
aeleeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggldf
lsvknascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlqr

SCOP Domain Coordinates for d1gzpa2:

Click to download the PDB-style file with coordinates for d1gzpa2.
(The format of our PDB-style files is described here.)

Timeline for d1gzpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gzpa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1gzpb_