Lineage for d1gzpa1 (1gzp A:184-280)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1106653Protein CD1, alpha-3 domain [88615] (4 species)
  7. 1106660Species Human (Homo sapiens), CD1b [TaxId:9606] [88617] (3 PDB entries)
  8. 1106662Domain d1gzpa1: 1gzp A:184-280 [70815]
    Other proteins in same PDB: d1gzpa2, d1gzpb_
    complexed with d12, gm2, twt

Details for d1gzpa1

PDB Entry: 1gzp (more details), 2.8 Å

PDB Description: cd1b in complex with gm2 ganglioside
PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d1gzpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gzpa1 b.1.1.2 (A:184-280) CD1, alpha-3 domain {Human (Homo sapiens), CD1b [TaxId: 9606]}
qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtw
ylratldvadgeaaglscrvkhsslegqdiilywgpg

SCOPe Domain Coordinates for d1gzpa1:

Click to download the PDB-style file with coordinates for d1gzpa1.
(The format of our PDB-style files is described here.)

Timeline for d1gzpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gzpa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1gzpb_