Lineage for d1gzgb_ (1gzg B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 237126Superfamily c.1.10: Aldolase [51569] (4 families) (S)
    Common fold covers whole protein structure
  5. 237313Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (1 protein)
    hybrid of classes I and II aldolase
  6. 237314Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (4 species)
  7. 237337Species Pseudomonas aeruginosa [TaxId:287] [51597] (2 PDB entries)
  8. 237339Domain d1gzgb_: 1gzg B: [70806]
    complexed with k, laf, mg, na, so4; mutant

Details for d1gzgb_

PDB Entry: 1gzg (more details), 1.66 Å

PDB Description: complex of a mg2-dependent porphobilinogen synthase from pseudomonas aeruginosa (mutant d139n) with 5-fluorolevulinic acid

SCOP Domain Sequences for d1gzgb_:

Sequence, based on SEQRES records: (download)

>d1gzgb_ c.1.10.3 (B:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Pseudomonas aeruginosa}
panraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverls
idqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgi
itdvaldpftthgqngildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgriga
irealesaghtnvrvmaysakyasayygpfrdavgsasnlgkgnkatyqmdpansdealh
evaadlaegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaes
vilesltafkragadgiltyfakqaaeqlrr

Sequence, based on observed residues (ATOM records): (download)

>d1gzgb_ c.1.10.3 (B:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Pseudomonas aeruginosa}
panraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverls
idqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgi
itdvaldpftthgqngildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgriga
irealesaghtnvrvmaysakyasayygpfrdavgskatyqmdpansdealhevaadlae
gadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaesvileslta
fkragadgiltyfakqaaeqlrr

SCOP Domain Coordinates for d1gzgb_:

Click to download the PDB-style file with coordinates for d1gzgb_.
(The format of our PDB-style files is described here.)

Timeline for d1gzgb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gzga_