Lineage for d1gzga_ (1gzg A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2097845Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins)
    hybrid of classes I and II aldolase
    automatically mapped to Pfam PF00490
  6. 2097846Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (5 species)
  7. 2097882Species Pseudomonas aeruginosa [TaxId:287] [51597] (2 PDB entries)
  8. 2097883Domain d1gzga_: 1gzg A: [70805]
    complexed with k, laf, mg, na, so4; mutant

Details for d1gzga_

PDB Entry: 1gzg (more details), 1.66 Å

PDB Description: complex of a mg2-dependent porphobilinogen synthase from pseudomonas aeruginosa (mutant d139n) with 5-fluorolevulinic acid
PDB Compounds: (A:) delta-aminolevulinic acid dehydratase

SCOPe Domain Sequences for d1gzga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gzga_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Pseudomonas aeruginosa [TaxId: 287]}
nraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverlsid
qllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgiit
dvaldpftthgqngildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgrigair
ealesaghtnvrvmaysakyasayygpfrdavgsasnlgkgnkatyqmdpansdealhev
aadlaegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaesvi
lesltafkragadgiltyfakqaaeqlrr

SCOPe Domain Coordinates for d1gzga_:

Click to download the PDB-style file with coordinates for d1gzga_.
(The format of our PDB-style files is described here.)

Timeline for d1gzga_: