Lineage for d1gzga_ (1gzg A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 174007Superfamily c.1.10: Aldolase [51569] (4 families) (S)
  5. 174188Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (1 protein)
  6. 174189Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (4 species)
  7. 174212Species Pseudomonas aeruginosa [TaxId:287] [51597] (2 PDB entries)
  8. 174213Domain d1gzga_: 1gzg A: [70805]

Details for d1gzga_

PDB Entry: 1gzg (more details), 1.66 Å

PDB Description: complex of a mg2-dependent porphobilinogen synthase from pseudomonas aeruginosa (mutant d139n) with 5-fluorolevulinic acid

SCOP Domain Sequences for d1gzga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gzga_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Pseudomonas aeruginosa}
nraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverlsid
qllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgiit
dvaldpftthgqngildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgrigair
ealesaghtnvrvmaysakyasayygpfrdavgsasnlgkgnkatyqmdpansdealhev
aadlaegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaesvi
lesltafkragadgiltyfakqaaeqlrr

SCOP Domain Coordinates for d1gzga_:

Click to download the PDB-style file with coordinates for d1gzga_.
(The format of our PDB-style files is described here.)

Timeline for d1gzga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gzgb_