SCOPe 2.05: Domain d1gzca_: 1gzc A:

Lineage for d1gzca_ (1gzc A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Cockspur coral tree (Erythrina crista-galli) [TaxId:49817] [74903] (5 PDB entries)
   Uniprot Q6YD91

8. Domain d1gzca_: 1gzc A: [70803]
   complexed with ca, lat, mn

Details for d1gzca_

PDB Entry: 1gzc, 1.58 Å

PDB Description: high-resolution crystal structure of erythrina cristagalli lectin in complex with lactose

PDB Compounds: (A:) erythrina crista-galli lectin

SCOPe Domain Sequences for d1gzca_:

Sequence; same for both SEQRES and ATOM records:

>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]}
vetisfsfsefepgndnltlqgaalitqsgvlqltkinqngmpawdstgrtlytkpvhmw
dsttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydapskilh
vvlvypssgaiytiaeivdvkqvlpdwvdvglsgatgaqrdaaethdvyswsfqaslpe

Timeline for d1gzca_:

• d1gzca_ first appeared in SCOP 1.61
  
• d1gzca_ appears in SCOPe 2.04
  
• d1gzca_ appears in SCOPe 2.06
  
• d1gzca_ appears in the current release, SCOPe 2.08