SCOPe 2.01: Domain d1gz9a_: 1gz9 A:

Lineage for d1gz9a_ (1gz9 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Cockspur coral tree (Erythrina crista-galli) [TaxId:49817] [74903] (5 PDB entries)
   Uniprot Q6YD91

8. Domain d1gz9a_: 1gz9 A: [70802]
   complexed with ca, mn

Details for d1gz9a_

PDB Entry: 1gz9, 1.7 Å

PDB Description: high-resolution crystal structure of erythrina cristagalli lectin in complex with 2'-alpha-l-fucosyllactose

PDB Compounds: (A:) erythrina crista-galli lectin

SCOPe Domain Sequences for d1gz9a_:

Sequence; same for both SEQRES and ATOM records:

>d1gz9a_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]}
vetisfsfsefepgndnltlqgaalitqsgvlqltkinqngmpawdstgrtlytkpvhmw
dsttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydapskilh
vvlvypssgaiytiaeivdvkqvlpdwvdvglsgatgaqrdaaethdvyswsfqaslpe

Timeline for d1gz9a_:

• d1gz9a_ first appeared in SCOP 1.61
  
• d1gz9a_ appears in SCOP 1.75
  
• d1gz9a_ appears in SCOPe 2.02
  
• d1gz9a_ appears in the current release, SCOPe 2.08