Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) |
Family c.58.1.3: Malic enzyme N-domain (Pfam 00390) [53240] (2 proteins) this domain is decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand |
Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [53242] (10 PDB entries) |
Domain d1gz4b2: 1gz4 B:23-279 [70797] Other proteins in same PDB: d1gz4a1, d1gz4b1, d1gz4c1, d1gz4d1 |
PDB Entry: 1gz4 (more details), 2.2 Å
SCOP Domain Sequences for d1gz4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gz4b2 c.58.1.3 (B:23-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens)} ekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtspleky iyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdrgh vrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclpvc idvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnhna frflrkyrekyctfndd
Timeline for d1gz4b2: