Lineage for d1gyza_ (1gyz A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 157231Fold a.144: PABP domain-like [63569] (2 superfamilies)
  4. 157242Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) (S)
  5. 157243Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein)
  6. 157244Protein Ribosomal protein L20 [74733] (1 species)
  7. 157245Species Aquifex aeolicus [TaxId:63363] [74734] (1 PDB entry)
  8. 157246Domain d1gyza_: 1gyz A: [70793]

Details for d1gyza_

PDB Entry: 1gyz (more details)

PDB Description: bacterial ribosomal protein l20 from aquifex aeolicus

SCOP Domain Sequences for d1gyza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gyza_ a.144.2.1 (A:) Ribosomal protein L20 {Aquifex aeolicus}
wiarinaavrayglnystfinglkkagieldrkiladmavrdpqafeqvvnkvkealqvq

SCOP Domain Coordinates for d1gyza_:

Click to download the PDB-style file with coordinates for d1gyza_.
(The format of our PDB-style files is described here.)

Timeline for d1gyza_: