Lineage for d1gytj1 (1gyt J:1-178)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 181576Fold c.50: Leucine aminopeptidase (Aminopeptidase A), N-terminal domain [52948] (1 superfamily)
  4. 181577Superfamily c.50.1: Leucine aminopeptidase (Aminopeptidase A), N-terminal domain [52949] (1 family) (S)
  5. 181578Family c.50.1.1: Leucine aminopeptidase (Aminopeptidase A), N-terminal domain [52950] (1 protein)
  6. 181579Protein Leucine aminopeptidase (Aminopeptidase A), N-terminal domain [52951] (2 species)
  7. 181589Species Escherichia coli, PepA [TaxId:562] [75241] (1 PDB entry)
  8. 181599Domain d1gytj1: 1gyt J:1-178 [70783]
    Other proteins in same PDB: d1gyta2, d1gytb2, d1gytc2, d1gytd2, d1gyte2, d1gytf2, d1gytg2, d1gyth2, d1gyti2, d1gytj2, d1gytk2, d1gytl2

Details for d1gytj1

PDB Entry: 1gyt (more details), 2.5 Å

PDB Description: e. coli aminopeptidase a (pepa)

SCOP Domain Sequences for d1gytj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gytj1 c.50.1.1 (J:1-178) Leucine aminopeptidase (Aminopeptidase A), N-terminal domain {Escherichia coli, PepA}
mefsvksgspekqrsacivvgvfeprrlspiaeqldkisdgyisallrrgelegkpgqtl
llhhvpnvlserilligcgkerelderqykqviqktintlndtgsmeavcfltelhvkgr
nnywkvrqavetaketlysfdqlktnkseprrplrkmvfnvptrreltsgeraiqhgl

SCOP Domain Coordinates for d1gytj1:

Click to download the PDB-style file with coordinates for d1gytj1.
(The format of our PDB-style files is described here.)

Timeline for d1gytj1: