Lineage for d1gyob_ (1gyo B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347197Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2347198Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2347199Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)
  6. 2347208Protein Cytochrome c3 [48697] (7 species)
    contains four heme groups
  7. 2347231Species Desulfovibrio gigas, di-tetraheme cytochrome c3 [TaxId:879] [74804] (1 PDB entry)
    disulfide-crosslinked dimer
  8. 2347233Domain d1gyob_: 1gyo B: [70764]
    complexed with gol, hec

Details for d1gyob_

PDB Entry: 1gyo (more details), 1.2 Å

PDB Description: crystal structure of the di-tetraheme cytochrome c3 from desulfovibrio gigas at 1.2 angstrom resolution
PDB Compounds: (B:) cytochrome c3, a dimeric class III c-type cytochrome

SCOPe Domain Sequences for d1gyob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gyob_ a.138.1.1 (B:) Cytochrome c3 {Desulfovibrio gigas, di-tetraheme cytochrome c3 [TaxId: 879]}
ldvpckvvitapegedphprfgkvemshakhrnvscvschhmfdgcgdfqkcadchidrd
drsyergfykawhseseiscrgchkamkakneqtgpigclqgchea

SCOPe Domain Coordinates for d1gyob_:

Click to download the PDB-style file with coordinates for d1gyob_.
(The format of our PDB-style files is described here.)

Timeline for d1gyob_: