Class a: All alpha proteins [46456] (289 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins) |
Protein Cytochrome c3 [48697] (7 species) contains four heme groups |
Species Desulfovibrio gigas, di-tetraheme cytochrome c3 [TaxId:879] [74804] (1 PDB entry) disulfide-crosslinked dimer |
Domain d1gyob_: 1gyo B: [70764] complexed with gol, hec |
PDB Entry: 1gyo (more details), 1.2 Å
SCOPe Domain Sequences for d1gyob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gyob_ a.138.1.1 (B:) Cytochrome c3 {Desulfovibrio gigas, di-tetraheme cytochrome c3 [TaxId: 879]} ldvpckvvitapegedphprfgkvemshakhrnvscvschhmfdgcgdfqkcadchidrd drsyergfykawhseseiscrgchkamkakneqtgpigclqgchea
Timeline for d1gyob_: