Lineage for d1gyoa_ (1gyo A:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) 
Family a.138.1.1: Cytochrome c3-like [48696] (3 proteins) Protein Cytochrome c3 [48697] (6 species) Species Desulfovibrio gigas, di-tetraheme cytochrome c3 [TaxId:879] [74804] (1 PDB entry) 
Domain d1gyoa_: 1gyo A: [70763]
Details for d1gyoa_
PDB Entry: 1gyo (more details), 1.2 Å
PDB Description: crystal structure of the di-tetraheme cytochrome c3 from desulfovibrio gigas at 1.2 angstrom resolution
SCOP Domain Sequences for d1gyoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gyoa_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio gigas, di-tetraheme cytochrome c3}
ldvpckvvitapegedphprfgkvemshakhrnvscvschhmfdgcgdfqkcadchidrd
drsyergfykawhseseiscrgchkamkakneqtgpigclqgchea
SCOP Domain Coordinates for d1gyoa_:
Click to download the PDB-style file with coordinates for d1gyoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gyoa_:
- d1gyoa_ is new in SCOP 1.61
- d1gyoa_ appears in SCOP 1.63
- d1gyoa_ appears in the current release, SCOPe 2.08
View in 3D
