SCOPe 2.02: Domain d1gyhf_: 1gyh F:

Lineage for d1gyhf_ (1gyh F:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
   consists of five 4-stranded beta-sheet motifs; meander

4. Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (5 families)

5. Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)

6. Protein alpha-L-arabinanase [75007] (1 species)

7. Species Cellvibrio cellulosa [TaxId:155077] [75008] (3 PDB entries)

8. Domain d1gyhf_: 1gyh F: [70762]
   complexed with cl; mutant

Details for d1gyhf_

PDB Entry: 1gyh, 1.89 Å

PDB Description: structure of d158a cellvibrio cellulosa alpha-l-arabinanase mutant

PDB Compounds: (F:) arabinan endo-1,5-alpha-l-arabinosidase a

SCOPe Domain Sequences for d1gyhf_:

Sequence; same for both SEQRES and ATOM records:

>d1gyhf_ b.67.2.1 (F:) alpha-L-arabinanase {Cellvibrio cellulosa [TaxId: 155077]}
akqvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsfd
ghlwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvpq
rdlwnaiapaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvlm
ddsqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgrd
mnqgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgegw
pqvdekeldsyisqrl

Timeline for d1gyhf_:

• d1gyhf_ first appeared in SCOP 1.61
  
• d1gyhf_ appears in SCOPe 2.01
  
• d1gyhf_ appears in SCOPe 2.03
  
• d1gyhf_ appears in the current release, SCOPe 2.08