SCOPe 2.05: Domain d1gyhd_: 1gyh D:

Lineage for d1gyhd_ (1gyh D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
   consists of five 4-stranded beta-sheet motifs; meander

4. Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families)

5. Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
   automatically mapped to Pfam PF04616

6. Protein alpha-L-arabinanase [75007] (1 species)

7. Species Cellvibrio cellulosa [TaxId:155077] [75008] (3 PDB entries)

8. Domain d1gyhd_: 1gyh D: [70760]
   complexed with cl; mutant

Details for d1gyhd_

PDB Entry: 1gyh, 1.89 Å

PDB Description: structure of d158a cellvibrio cellulosa alpha-l-arabinanase mutant

PDB Compounds: (D:) arabinan endo-1,5-alpha-l-arabinosidase a

SCOPe Domain Sequences for d1gyhd_:

Sequence; same for both SEQRES and ATOM records:

>d1gyhd_ b.67.2.1 (D:) alpha-L-arabinanase {Cellvibrio cellulosa [TaxId: 155077]}
akqvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsfd
ghlwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvpq
rdlwnaiapaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvlm
ddsqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgrd
mnqgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgegw
pqvdekeldsyisqrl

Timeline for d1gyhd_:

• d1gyhd_ first appeared in SCOP 1.61
  
• d1gyhd_ appears in SCOPe 2.04
  
• d1gyhd_ appears in SCOPe 2.06
  
• d1gyhd_ appears in the current release, SCOPe 2.08