Lineage for d1gyhc_ (1gyh C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1134549Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 1134555Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (5 families) (S)
  5. 1134556Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
  6. 1134557Protein alpha-L-arabinanase [75007] (1 species)
  7. 1134558Species Cellvibrio cellulosa [TaxId:155077] [75008] (3 PDB entries)
  8. 1134561Domain d1gyhc_: 1gyh C: [70759]
    complexed with cl; mutant

Details for d1gyhc_

PDB Entry: 1gyh (more details), 1.89 Å

PDB Description: structure of d158a cellvibrio cellulosa alpha-l-arabinanase mutant
PDB Compounds: (C:) arabinan endo-1,5-alpha-l-arabinosidase a

SCOPe Domain Sequences for d1gyhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gyhc_ b.67.2.1 (C:) alpha-L-arabinanase {Cellvibrio cellulosa [TaxId: 155077]}
gakqvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsf
dghlwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvp
qrdlwnaiapaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvl
mddsqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgr
dmnqgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgeg
wpqvdekeldsyisqrlk

SCOPe Domain Coordinates for d1gyhc_:

Click to download the PDB-style file with coordinates for d1gyhc_.
(The format of our PDB-style files is described here.)

Timeline for d1gyhc_: