Lineage for d1gyhb_ (1gyh B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1802003Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 1802009Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 1802010Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
    automatically mapped to Pfam PF04616
  6. 1802011Protein alpha-L-arabinanase [75007] (1 species)
  7. 1802012Species Cellvibrio cellulosa [TaxId:155077] [75008] (3 PDB entries)
  8. 1802014Domain d1gyhb_: 1gyh B: [70758]
    complexed with cl; mutant

Details for d1gyhb_

PDB Entry: 1gyh (more details), 1.89 Å

PDB Description: structure of d158a cellvibrio cellulosa alpha-l-arabinanase mutant
PDB Compounds: (B:) arabinan endo-1,5-alpha-l-arabinosidase a

SCOPe Domain Sequences for d1gyhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gyhb_ b.67.2.1 (B:) alpha-L-arabinanase {Cellvibrio cellulosa [TaxId: 155077]}
akqvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsfd
ghlwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvpq
rdlwnaiapaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvlm
ddsqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgrd
mnqgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgegw
pqvdekeldsyisqrlk

SCOPe Domain Coordinates for d1gyhb_:

Click to download the PDB-style file with coordinates for d1gyhb_.
(The format of our PDB-style files is described here.)

Timeline for d1gyhb_: