Lineage for d1gyha_ (1gyh A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170550Fold b.67: 5-bladed beta-propeller [50933] (2 superfamilies)
  4. 170556Superfamily b.67.2: alpha-L-arabinanase [75005] (1 family) (S)
  5. 170557Family b.67.2.1: alpha-L-arabinanase [75006] (1 protein)
  6. 170558Protein alpha-L-arabinanase [75007] (1 species)
  7. 170559Species Cellvibrio cellulosa [TaxId:155077] [75008] (3 PDB entries)
  8. 170560Domain d1gyha_: 1gyh A: [70757]

Details for d1gyha_

PDB Entry: 1gyh (more details), 1.89 Å

PDB Description: structure of d158a cellvibrio cellulosa alpha-l-arabinanase mutant

SCOP Domain Sequences for d1gyha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gyha_ b.67.2.1 (A:) alpha-L-arabinanase {Cellvibrio cellulosa}
gakqvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsf
dghlwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvp
qrdlwnaiapaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvl
mddsqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgr
dmnqgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgeg
wpqvdekeldsyisqrlk

SCOP Domain Coordinates for d1gyha_:

Click to download the PDB-style file with coordinates for d1gyha_.
(The format of our PDB-style files is described here.)

Timeline for d1gyha_: