Lineage for d1gyeb_ (1gye B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1802003Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 1802009Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 1802010Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
    automatically mapped to Pfam PF04616
  6. 1802011Protein alpha-L-arabinanase [75007] (1 species)
  7. 1802012Species Cellvibrio cellulosa [TaxId:155077] [75008] (3 PDB entries)
  8. 1802020Domain d1gyeb_: 1gye B: [70752]
    complexed with cl

Details for d1gyeb_

PDB Entry: 1gye (more details), 2.5 Å

PDB Description: structure of cellvibrio cellulosa alpha-l-arabinanase complexed with arabinohexaose
PDB Compounds: (B:) arabinan endo-1,5-alpha-l-arabinosidase a

SCOPe Domain Sequences for d1gyeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gyeb_ b.67.2.1 (B:) alpha-L-arabinanase {Cellvibrio cellulosa [TaxId: 155077]}
kqvdvhdpvmtregatwylfstgpgitiysskdrvnwrysdrafateptwakrvspsfdg
hlwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvpqr
dlwnaiapaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvlmd
dsqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgrdm
nqgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgegwp
qvdekeldsyisqrl

SCOPe Domain Coordinates for d1gyeb_:

Click to download the PDB-style file with coordinates for d1gyeb_.
(The format of our PDB-style files is described here.)

Timeline for d1gyeb_: