![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies) consists of five 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (5 families) ![]() |
![]() | Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins) |
![]() | Protein alpha-L-arabinanase [75007] (1 species) |
![]() | Species Cellvibrio cellulosa [TaxId:155077] [75008] (3 PDB entries) |
![]() | Domain d1gydb_: 1gyd B: [70751] |
PDB Entry: 1gyd (more details), 2.05 Å
SCOPe Domain Sequences for d1gydb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gydb_ b.67.2.1 (B:) alpha-L-arabinanase {Cellvibrio cellulosa [TaxId: 155077]} qvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsfdgh lwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvpqrd lwnaidpaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvlmdd sqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgrdmn qgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgegwpq vdekeldsyisqrlk
Timeline for d1gydb_: