Lineage for d1gydb_ (1gyd B:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.67: 5-bladed beta-propeller [50933] (2 superfamilies) Superfamily b.67.2: alpha-L-arabinanase [75005] (1 family) 
Family b.67.2.1: alpha-L-arabinanase [75006] (1 protein) Protein alpha-L-arabinanase [75007] (1 species) Species Cellvibrio cellulosa [TaxId:155077] [75008] (3 PDB entries) 
Domain d1gydb_: 1gyd B: [70751]
Details for d1gydb_
PDB Entry: 1gyd (more details), 2.05 Å
PDB Description: structure of cellvibrio cellulosa alpha-l-arabinanase
SCOP Domain Sequences for d1gydb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gydb_ b.67.2.1 (B:) alpha-L-arabinanase {Cellvibrio cellulosa}
qvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsfdgh
lwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvpqrd
lwnaidpaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvlmdd
sqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgrdmn
qgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgegwpq
vdekeldsyisqrlk
SCOP Domain Coordinates for d1gydb_:
Click to download the PDB-style file with coordinates for d1gydb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gydb_:
- d1gydb_ is new in SCOP 1.61
- d1gydb_ appears in SCOP 1.63
- d1gydb_ appears in the current release, SCOPe 2.08
View in 3D