Lineage for d1gybc_ (1gyb C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1896198Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1896222Family d.17.4.2: NTF2-like [54431] (6 proteins)
  6. 1896244Protein Nuclear transport factor-2 (NTF2) [54432] (4 species)
  7. 1896245Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75374] (2 PDB entries)
  8. 1896252Domain d1gybc_: 1gyb C: [70746]
    complexed with FxFG nucleoporin repeat
    mutant

Details for d1gybc_

PDB Entry: 1gyb (more details), 1.9 Å

PDB Description: n77y point mutant of yntf2 bound to fxfg nucleoporin repeat
PDB Compounds: (C:) nuclear transport factor 2

SCOPe Domain Sequences for d1gybc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gybc_ d.17.4.2 (C:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fntlaqnftqfyynqfdtdrsqlgnlyrnesmltfetsqlqgakdiveklvslpfqkvqh
rittldaqpaspygdvlvmitgdllideeqnpqrfsqvfhlipdgnsyyvfndifrlnys

SCOPe Domain Coordinates for d1gybc_:

Click to download the PDB-style file with coordinates for d1gybc_.
(The format of our PDB-style files is described here.)

Timeline for d1gybc_: