Lineage for d1gy7c_ (1gy7 C:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.17: Cystatin-like [54402] (5 superfamilies) Superfamily d.17.4: NTF2-like [54427] (4 families) 
Family d.17.4.2: NTF2-like [54431] (3 proteins) Protein Nuclear transport factor-2 (NTF2) [54432] (3 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75374] (2 PDB entries) 
Domain d1gy7c_: 1gy7 C: [70740]
Details for d1gy7c_
PDB Entry: 1gy7 (more details), 1.6 Å
PDB Description: n77y point mutant of s.cerevisiae ntf2
SCOP Domain Sequences for d1gy7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gy7c_ d.17.4.2 (C:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae)}
ntlaqnftqfyynqfdtdrsqlgnlyrnesmltfetsqlqgakdiveklvslpfqkvqhr
ittldaqpaspygdvlvmitgdllideeqnpqrfsqvfhlipdgnsyyvfndifrlnys
SCOP Domain Coordinates for d1gy7c_:
Click to download the PDB-style file with coordinates for d1gy7c_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gy7c_:
- d1gy7c_ is new in SCOP 1.61
- d1gy7c_ appears in SCOP 1.63
- d1gy7c_ appears in the current release, SCOPe 2.08
View in 3D
