SCOP 1.71: Domain d1gy7b_: 1gy7 B:

Lineage for d1gy7b_ (1gy7 B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (12 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.2: NTF2-like [54431] (5 proteins)

6. Protein Nuclear transport factor-2 (NTF2) [54432] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75374] (2 PDB entries)

8. Domain d1gy7b_: 1gy7 B: [70739]

Details for d1gy7b_

PDB Entry: 1gy7, 1.6 Å

PDB Description: n77y point mutant of s.cerevisiae ntf2

SCOP Domain Sequences for d1gy7b_:

Sequence; same for both SEQRES and ATOM records:

>d1gy7b_ d.17.4.2 (B:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae)}
ldfntlaqnftqfyynqfdtdrsqlgnlyrnesmltfetsqlqgakdiveklvslpfqkv
qhrittldaqpaspygdvlvmitgdllideeqnpqrfsqvfhlipdgnsyyvfndifrln
ys

Timeline for d1gy7b_:

• d1gy7b_ first appeared in SCOP 1.61
  
• d1gy7b_ appears in SCOP 1.69
  
• d1gy7b_ appears in SCOP 1.73
  
• d1gy7b_ appears in the current release, SCOPe 2.08