Lineage for d1gy7a_ (1gy7 A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190011Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 190149Superfamily d.17.4: NTF2-like [54427] (4 families) (S)
  5. 190170Family d.17.4.2: NTF2-like [54431] (3 protein domains)
  6. 190179Protein Nuclear transport factor-2 (NTF2) [54432] (3 species)
  7. 190180Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75374] (2 PDB entries)
  8. 190181Domain d1gy7a_: 1gy7 A: [70738]

Details for d1gy7a_

PDB Entry: 1gy7 (more details), 1.6 Å

PDB Description: n77y point mutant of s.cerevisiae ntf2

SCOP Domain Sequences for d1gy7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae)}
dfntlaqnftqfyynqfdtdrsqlgnlyrnesmltfetsqlqgakdiveklvslpfqkvq
hrittldaqpaspygdvlvmitgdllideeqnpqrfsqvfhlipdgnsyyvfndifrlny
s

SCOP Domain Coordinates for d1gy7a_:

Click to download the PDB-style file with coordinates for d1gy7a_.
(The format of our PDB-style files is described here.)

Timeline for d1gy7a_: