Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (12 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.2: NTF2-like [54431] (5 proteins) |
Protein Nuclear transport factor-2 (NTF2) [54432] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [75373] (1 PDB entry) |
Domain d1gy5a_: 1gy5 A: [70734] |
PDB Entry: 1gy5 (more details), 2.3 Å
SCOP Domain Sequences for d1gy5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gy5a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Human (Homo sapiens)} kpiweqigssfiqhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpfqk iqhsitaqdhqptpdsciismvvgqlkanenpimgfhqmfllknindawvctndmfrlal hnf
Timeline for d1gy5a_: