Lineage for d1gy5a_ (1gy5 A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190011Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 190149Superfamily d.17.4: NTF2-like [54427] (4 families) (S)
  5. 190170Family d.17.4.2: NTF2-like [54431] (3 proteins)
  6. 190179Protein Nuclear transport factor-2 (NTF2) [54432] (3 species)
  7. 190189Species Human (Homo sapiens) [TaxId:9606] [75373] (1 PDB entry)
  8. 190190Domain d1gy5a_: 1gy5 A: [70734]

Details for d1gy5a_

PDB Entry: 1gy5 (more details), 2.3 Å

PDB Description: d92n,d94n double point mutant of human nuclear transport factor 2 (ntf2)

SCOP Domain Sequences for d1gy5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gy5a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Human (Homo sapiens)}
kpiweqigssfiqhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpfqk
iqhsitaqdhqptpdsciismvvgqlkanenpimgfhqmfllknindawvctndmfrlal
hnf

SCOP Domain Coordinates for d1gy5a_:

Click to download the PDB-style file with coordinates for d1gy5a_.
(The format of our PDB-style files is described here.)

Timeline for d1gy5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gy5b_