Class b: All beta proteins [48724] (177 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein Rusticyanin [49537] (1 species) |
Species Thiobacillus ferrooxidans [TaxId:920] [49538] (7 PDB entries) |
Domain d1gy2a_: 1gy2 A: [70726] complexed with cu, gol |
PDB Entry: 1gy2 (more details), 1.82 Å
SCOPe Domain Sequences for d1gy2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gy2a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} gtldttwkeatlpqvkamlekdtgkvsgdtvtysgktvhvvaaavlpgfpfpsfevhdkk nptleipagatvdvtfintnkgfghsfditkkgppyavmpvidpivagtgfspvpkdgkf gytnftwhptagtyyyvcqipghaatglfgkivvk
Timeline for d1gy2a_: