SCOPe 2.06: Domain d1gy2a_: 1gy2 A:

Lineage for d1gy2a_ (1gy2 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Rusticyanin [49537] (1 species)

7. Species Thiobacillus ferrooxidans [TaxId:920] [49538] (7 PDB entries)

8. Domain d1gy2a_: 1gy2 A: [70726]
   complexed with cu, gol

Details for d1gy2a_

PDB Entry: 1gy2, 1.82 Å

PDB Description: crystal structure of met148leu rusticyanin

PDB Compounds: (A:) rusticyanin

SCOPe Domain Sequences for d1gy2a_:

Sequence; same for both SEQRES and ATOM records:

>d1gy2a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]}
gtldttwkeatlpqvkamlekdtgkvsgdtvtysgktvhvvaaavlpgfpfpsfevhdkk
nptleipagatvdvtfintnkgfghsfditkkgppyavmpvidpivagtgfspvpkdgkf
gytnftwhptagtyyyvcqipghaatglfgkivvk

Timeline for d1gy2a_:

• d1gy2a_ first appeared in SCOP 1.61
  
• d1gy2a_ appears in SCOPe 2.05
  
• d1gy2a_ appears in SCOPe 2.07
  
• d1gy2a_ appears in the current release, SCOPe 2.08