Lineage for d1gxra_ (1gxr A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 565655Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 565717Superfamily b.69.4: WD40 repeat-like [50978] (2 families) (S)
    also contains 8-bladed propellers
  5. 565718Family b.69.4.1: WD40-repeat [50979] (8 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 565762Protein Groucho/tle1, C-terminal domain [75009] (1 species)
  7. 565763Species Human (Homo sapiens) [TaxId:9606] [75010] (1 PDB entry)
  8. 565764Domain d1gxra_: 1gxr A: [70722]

Details for d1gxra_

PDB Entry: 1gxr (more details), 1.65 Å

PDB Description: wd40 region of human groucho/tle1

SCOP Domain Sequences for d1gxra_:

Sequence, based on SEQRES records: (download)

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens)}
dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
lsiwdlaaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfq
ghtdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewla
vgmessnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasi
fqskesssvlscdisvddkyivtgsgdkkatvyeviy

Sequence, based on observed residues (ATOM records): (download)

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens)}
dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
lsiwdlaaprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfqgh
tdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewlavg
messnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasifq
skesssvlscdisvddkyivtgsgdkkatvyeviy

SCOP Domain Coordinates for d1gxra_:

Click to download the PDB-style file with coordinates for d1gxra_.
(The format of our PDB-style files is described here.)

Timeline for d1gxra_: