Lineage for d1gxka_ (1gxk A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006814Fold d.215: Smc hinge domain [75552] (1 superfamily)
    consists of 2 different alpha+beta subdomains; forms subdomain-swapped dimers
  4. 3006815Superfamily d.215.1: Smc hinge domain [75553] (2 families) (S)
  5. 3006816Family d.215.1.1: Smc hinge domain [75554] (1 protein)
  6. 3006817Protein Smc hinge domain [75555] (1 species)
  7. 3006818Species Thermotoga maritima [TaxId:2336] [75556] (3 PDB entries)
  8. 3006821Domain d1gxka_: 1gxk A: [70709]

Details for d1gxka_

PDB Entry: 1gxk (more details), 3 Å

PDB Description: smc hinge domain from t. maritima w/o coiled coil, p212121 crystal form
PDB Compounds: (A:) chromosome segregation smc protein

SCOPe Domain Sequences for d1gxka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxka_ d.215.1.1 (A:) Smc hinge domain {Thermotoga maritima [TaxId: 2336]}
ravravfeekerfpglvdvvsnlievdekyslavsvllggtaqnivvrnvdtakaivefl
kqneagrvtilpldlidgsfnrisglenergfvgyavdlvkfpsdlevlggflfgnsvvv
etlddairmkkkyrlntriatldgelisgrgaitggre

SCOPe Domain Coordinates for d1gxka_:

Click to download the PDB-style file with coordinates for d1gxka_.
(The format of our PDB-style files is described here.)

Timeline for d1gxka_: