Lineage for d1gxha_ (1gxh A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536898Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 536938Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) (S)
  5. 536939Family a.28.2.1: Colicin E immunity proteins [47346] (3 proteins)
  6. 536952Protein ImmE8 (Im8) [47349] (1 species)
  7. 536953Species Escherichia coli [TaxId:562] [47350] (2 PDB entries)
  8. 536955Domain d1gxha_: 1gxh A: [70706]

Details for d1gxha_

PDB Entry: 1gxh (more details)

PDB Description: colicin e8 dnase immunity protein: im8

SCOP Domain Sequences for d1gxha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxha_ a.28.2.1 (A:) ImmE8 (Im8) {Escherichia coli}
melknsisdytetefkkiiediincegdekkqddnlehfisvtehpsgsdliyypegnnd
gspeavikeikewraangksgfkqg

SCOP Domain Coordinates for d1gxha_:

Click to download the PDB-style file with coordinates for d1gxha_.
(The format of our PDB-style files is described here.)

Timeline for d1gxha_: