Lineage for d1gxdc_ (1gxd C:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.40: OB-fold [50198] (8 superfamilies) 
Superfamily b.40.3: TIMP-like [50242] (2 families) 
Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins) Protein TIMP-2 [50246] (2 species) Species Human (Homo sapiens) [TaxId:9606] [50247] (3 PDB entries) 
Domain d1gxdc_: 1gxd C: [70703]
Other proteins in same PDB: d1gxda1, d1gxda2, d1gxda3, d1gxda4, d1gxda5, d1gxda6, d1gxdb1, d1gxdb2, d1gxdb3, d1gxdb4, d1gxdb5, d1gxdb6
Details for d1gxdc_
PDB Entry: 1gxd (more details), 3.1 Å
PDB Description: prommp-2/timp-2 complex
SCOP Domain Sequences for d1gxdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gxdc_ b.40.3.1 (C:) TIMP-2 {Human (Homo sapiens)}
cscspvhpqqafcnadvvirakavsekevdsgndiygnpikriqyeikqikmfkgpekdi
efiytapssavcgvsldvggkkeyliagkaegdgkmhitlcdfivpwdtlsttqkkslnh
ryqmgceckitrcpmipcyisspdeclwmdwvtekninghqakffacikrsdgscawyrg
aappkqefldie
SCOP Domain Coordinates for d1gxdc_:
Click to download the PDB-style file with coordinates for d1gxdc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gxdc_:
- d1gxdc_ is new in SCOP 1.61
- d1gxdc_ appears in SCOP 1.63
- d1gxdc_ appears in the current release, SCOPe 2.08
View in 3D
