Class g: Small proteins [56992] (79 folds) |
Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (2 families) |
Family g.14.1.2: Fibronectin type II module [57459] (4 proteins) shorter two-disulfide version of a kringle module |
Protein Gelatinase A (MMP-2) type II modules [57464] (1 species) duplication: tandem repeat of three modules inserted in the catalytic domain |
Species Human (Homo sapiens) [TaxId:9606] [57465] (6 PDB entries) |
Domain d1gxdb6: 1gxd B:309-364 [70702] Other proteins in same PDB: d1gxda1, d1gxda2, d1gxda3, d1gxdb1, d1gxdb2, d1gxdb3, d1gxdc_, d1gxdd_ complexed with ca, so4, zn; mutant |
PDB Entry: 1gxd (more details), 3.1 Å
SCOP Domain Sequences for d1gxdb6:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gxdb6 g.14.1.2 (B:309-364) Gelatinase A (MMP-2) type II modules {Human (Homo sapiens)} stvggnsegapcvfpftflgnkyesctsagrsdgkmwcattanydddrkwgfcpdq
Timeline for d1gxdb6: