SCOP 1.71: Domain d1gxdb6: 1gxd B:309-364

Lineage for d1gxdb6 (1gxd B:309-364)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (2 families)

5. Family g.14.1.2: Fibronectin type II module [57459] (4 proteins)
   shorter two-disulfide version of a kringle module

6. Protein Gelatinase A (MMP-2) type II modules [57464] (1 species)
   duplication: tandem repeat of three modules inserted in the catalytic domain

7. Species Human (Homo sapiens) [TaxId:9606] [57465] (6 PDB entries)

8. Domain d1gxdb6: 1gxd B:309-364 [70702]
   Other proteins in same PDB: d1gxda1, d1gxda2, d1gxda3, d1gxdb1, d1gxdb2, d1gxdb3, d1gxdc_, d1gxdd_
   complexed with ca, so4, zn; mutant

Details for d1gxdb6

PDB Entry: 1gxd, 3.1 Å

PDB Description: prommp-2/timp-2 complex

SCOP Domain Sequences for d1gxdb6:

Sequence; same for both SEQRES and ATOM records:

>d1gxdb6 g.14.1.2 (B:309-364) Gelatinase A (MMP-2) type II modules {Human (Homo sapiens)}
stvggnsegapcvfpftflgnkyesctsagrsdgkmwcattanydddrkwgfcpdq

Timeline for d1gxdb6:

• d1gxdb6 first appeared in SCOP 1.61
  
• d1gxdb6 appears in SCOP 1.69
  
• d1gxdb6 appears in SCOP 1.73
  
• d1gxdb6 appears in the current release, SCOPe 2.08