Lineage for d1gxdb2 (1gxd B:429-631)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 565285Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
    consists of four 4-stranded beta-sheet motifs; meander
  4. 565286Superfamily b.66.1: Hemopexin-like domain [50923] (1 family) (S)
  5. 565287Family b.66.1.1: Hemopexin-like domain [50924] (5 proteins)
  6. 565297Protein Gelatinase A (MMP-2), C-terminal domain [50927] (1 species)
  7. 565298Species Human (Homo sapiens) [TaxId:9606] [50928] (4 PDB entries)
  8. 565303Domain d1gxdb2: 1gxd B:429-631 [70698]
    Other proteins in same PDB: d1gxda1, d1gxda3, d1gxda4, d1gxda5, d1gxda6, d1gxdb1, d1gxdb3, d1gxdb4, d1gxdb5, d1gxdb6, d1gxdc_, d1gxdd_
    complexed with ca, so4, zn; mutant

Details for d1gxdb2

PDB Entry: 1gxd (more details), 3.1 Å

PDB Description: prommp-2/timp-2 complex

SCOP Domain Sequences for d1gxdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxdb2 b.66.1.1 (B:429-631) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens)}
tptlgpvtpeickqdivfdgiaqirgeifffkdrfiwrtvtprdkpmgpllvatfwpelp
ekidavyeapqeekavffagneywiysastlergypkpltslglppdvqrvdaafnwskn
kktyifagdkfwrynevkkkmdpgfpkliadawnaipdnldavvdlqggghsyffkgayy
lklenqslksvkfgsiksdwlgc

SCOP Domain Coordinates for d1gxdb2:

Click to download the PDB-style file with coordinates for d1gxdb2.
(The format of our PDB-style files is described here.)

Timeline for d1gxdb2: