Class a: All alpha proteins [46456] (289 folds) |
Fold a.20: PGBD-like [47089] (1 superfamily) core: 3 helices; bundle, closed, left-handed twist; parallel |
Superfamily a.20.1: PGBD-like [47090] (3 families) |
Family a.20.1.2: MMP N-terminal domain [63427] (4 proteins) |
Protein Gelatinase A (MMP-2) [63428] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63430] (3 PDB entries) |
Domain d1gxdb1: 1gxd B:2-78 [70697] Other proteins in same PDB: d1gxda2, d1gxda3, d1gxda4, d1gxda5, d1gxda6, d1gxdb2, d1gxdb3, d1gxdb4, d1gxdb5, d1gxdb6, d1gxdc_, d1gxdd_ complexed with ca, so4, zn |
PDB Entry: 1gxd (more details), 3.1 Å
SCOPe Domain Sequences for d1gxdb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gxdb1 a.20.1.2 (B:2-78) Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 9606]} pspiikfpgdvapktdkelavqylntfygcpkescnlfvlkdtlkkmqkffglpqtgdld qntietmrkprcgnpdv
Timeline for d1gxdb1: