SCOP 1.65: Domain d1gxda3: 1gxd A:79-187,A:365-421

Lineage for d1gxda3 (1gxd A:79-187,A:365-421)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (11 proteins)

6. Protein Gelatinase A [55534] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55535] (4 PDB entries)

8. Domain d1gxda3: 1gxd A:79-187,A:365-421 [70693]
   Other proteins in same PDB: d1gxda1, d1gxda2, d1gxda4, d1gxda5, d1gxda6, d1gxdb1, d1gxdb2, d1gxdb4, d1gxdb5, d1gxdb6, d1gxdc_, d1gxdd_

Details for d1gxda3

PDB Entry: 1gxd, 3.1 Å

PDB Description: prommp-2/timp-2 complex

SCOP Domain Sequences for d1gxda3:

Sequence; same for both SEQRES and ATOM records:

>d1gxda3 d.92.1.11 (A:79-187,A:365-421) Gelatinase A {Human (Homo sapiens)}
anynffprkpkwdknqityriigytpdldpetvddafarafqvwsdvtplrfsrihdgea
diminfgrwehgdgypfdgkdgllahafapgtgvggdshfdddelwtlgXgyslflvaah
afghamglehsqdpgalmapiytytknfrlsqddikgiqelygaspd

Timeline for d1gxda3:

• d1gxda3 first appeared in SCOP 1.61
  
• d1gxda3 appears in SCOP 1.63
  
• d1gxda3 appears in SCOP 1.67
  
• d1gxda3 appears in the current release, SCOPe 2.08