Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (11 proteins) |
Protein Gelatinase A [55534] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55535] (4 PDB entries) |
Domain d1gxda3: 1gxd A:79-187,A:365-421 [70693] Other proteins in same PDB: d1gxda1, d1gxda2, d1gxda4, d1gxda5, d1gxda6, d1gxdb1, d1gxdb2, d1gxdb4, d1gxdb5, d1gxdb6, d1gxdc_, d1gxdd_ |
PDB Entry: 1gxd (more details), 3.1 Å
SCOP Domain Sequences for d1gxda3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gxda3 d.92.1.11 (A:79-187,A:365-421) Gelatinase A {Human (Homo sapiens)} anynffprkpkwdknqityriigytpdldpetvddafarafqvwsdvtplrfsrihdgea diminfgrwehgdgypfdgkdgllahafapgtgvggdshfdddelwtlgXgyslflvaah afghamglehsqdpgalmapiytytknfrlsqddikgiqelygaspd
Timeline for d1gxda3: