Lineage for d1gxda1 (1gxd A:1-78)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311282Fold a.20: PGBD-like [47089] (1 superfamily)
    core: 3 helices; bundle, closed, left-handed twist; parallel
  4. 2311283Superfamily a.20.1: PGBD-like [47090] (3 families) (S)
  5. 2311293Family a.20.1.2: MMP N-terminal domain [63427] (4 proteins)
  6. 2311298Protein Gelatinase A (MMP-2) [63428] (1 species)
  7. 2311299Species Human (Homo sapiens) [TaxId:9606] [63430] (3 PDB entries)
  8. 2311305Domain d1gxda1: 1gxd A:1-78 [70691]
    Other proteins in same PDB: d1gxda2, d1gxda3, d1gxda4, d1gxda5, d1gxda6, d1gxdb2, d1gxdb3, d1gxdb4, d1gxdb5, d1gxdb6, d1gxdc_, d1gxdd_
    complexed with ca, so4, zn

Details for d1gxda1

PDB Entry: 1gxd (more details), 3.1 Å

PDB Description: prommp-2/timp-2 complex
PDB Compounds: (A:) 72 kda type IV collagenase

SCOPe Domain Sequences for d1gxda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxda1 a.20.1.2 (A:1-78) Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 9606]}
apspiikfpgdvapktdkelavqylntfygcpkescnlfvlkdtlkkmqkffglpqtgdl
dqntietmrkprcgnpdv

SCOPe Domain Coordinates for d1gxda1:

Click to download the PDB-style file with coordinates for d1gxda1.
(The format of our PDB-style files is described here.)

Timeline for d1gxda1: