Lineage for d1gxcg_ (1gxc G:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164426Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
  4. 164427Superfamily b.26.1: SMAD/FHA domain [49879] (2 families) (S)
  5. 164449Family b.26.1.2: FHA domain [49885] (3 proteins)
  6. 164455Protein Chk2 kinase [74901] (1 species)
  7. 164456Species Human (Homo sapiens) [TaxId:9606] [74902] (1 PDB entry)
  8. 164459Domain d1gxcg_: 1gxc G: [70689]

Details for d1gxcg_

PDB Entry: 1gxc (more details), 2.7 Å

PDB Description: fha domain from human chk2 kinase in complex with a synthetic phosphopeptide

SCOP Domain Sequences for d1gxcg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxcg_ b.26.1.2 (G:) Chk2 kinase {Human (Homo sapiens)}
pwarlwalqdgfanlecvndnywfgrdksceycfdepllkrtdkyrtyskkhfrifrevg
pknsyiayiedhsgngtfvntelvgkgkrrplnnnseialslsrnkvfvffdltvd

SCOP Domain Coordinates for d1gxcg_:

Click to download the PDB-style file with coordinates for d1gxcg_.
(The format of our PDB-style files is described here.)

Timeline for d1gxcg_: