SCOP 1.71: Domain d1gxaa_: 1gxa A:

Lineage for d1gxaa_ (1gxa A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (5 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (19 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein beta-Lactoglobulin [50827] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50828] (16 PDB entries)

8. Domain d1gxaa_: 1gxa A: [70686]
   complexed with plm

Details for d1gxaa_

PDB Entry: 1gxa, 2.35 Å

PDB Description: bovine beta-lactoglobulin complexed with retinol and palmitic acid, trigonal lattice z

SCOP Domain Sequences for d1gxaa_:

Sequence; same for both SEQRES and ATOM records:

>d1gxaa_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus)}
ivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkw
engecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqc
lvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

Timeline for d1gxaa_:

• d1gxaa_ first appeared in SCOP 1.61
  
• d1gxaa_ appears in SCOP 1.69
  
• d1gxaa_ appears in SCOP 1.73
  
• d1gxaa_ appears in the current release, SCOPe 2.08