Lineage for d1gx8a_ (1gx8 A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 232449Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 232450Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
    bind hydrophobic ligands in their interior
  5. 232451Family b.60.1.1: Retinol binding protein-like [50815] (16 proteins)
    barrel, closed; n=8, S=12, meander
  6. 232466Protein beta-Lactoglobulin [50827] (2 species)
  7. 232467Species Cow (Bos taurus) [TaxId:9913] [50828] (15 PDB entries)
  8. 232477Domain d1gx8a_: 1gx8 A: [70684]
    complexed with rtl

Details for d1gx8a_

PDB Entry: 1gx8 (more details), 2.4 Å

PDB Description: bovine beta-lactoglobulin complexed with retinol, trigonal lattice z

SCOP Domain Sequences for d1gx8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gx8a_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus)}
ivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkw
engecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqc
lvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

SCOP Domain Coordinates for d1gx8a_:

Click to download the PDB-style file with coordinates for d1gx8a_.
(The format of our PDB-style files is described here.)

Timeline for d1gx8a_: