Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (16 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.5: Arylamine N-acetyltransferase [54047] (1 protein) fold similar to that of the factor XIII catalytic domain |
Protein Arylamine N-acetyltransferase [54048] (4 species) |
Species Mycobacterium smegmatis [TaxId:1772] [75335] (3 PDB entries) |
Domain d1gx3d_: 1gx3 D: [70681] |
PDB Entry: 1gx3 (more details), 1.7 Å
SCOP Domain Sequences for d1gx3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gx3d_ d.3.1.5 (D:) Arylamine N-acetyltransferase {Mycobacterium smegmatis [TaxId: 1772]} amdlggyltrigldgrprpdlgtlhaivaahnrsipfenldpllgipvadlsaealfakl vdrrrggycyehngllgyvleelgfeverlsgrvvwmraddaplpaqthnvlsvavpgad grylvdvgfggqtltspirleagpvqqtrhepyrltrhgddhtlaaqvrgewqplytftt eprpridlevgswyvsthpgshfvtgltvavvtddarynlrgrnlavhrsgatehirfds aaqvldaivnrfgidlgdlagrdvqarvaevldt
Timeline for d1gx3d_: