Lineage for d1gx3d_ (1gx3 D:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 188207Fold d.3: Cysteine proteinases [54000] (1 superfamily)
  4. 188208Superfamily d.3.1: Cysteine proteinases [54001] (8 families) (S)
  5. 188398Family d.3.1.5: Arylamine N-acetyltransferase [54047] (1 protein)
  6. 188399Protein Arylamine N-acetyltransferase [54048] (2 species)
  7. 188400Species Mycobacterium smegmatis [TaxId:1772] [75335] (1 PDB entry)
  8. 188404Domain d1gx3d_: 1gx3 D: [70681]

Details for d1gx3d_

PDB Entry: 1gx3 (more details), 1.7 Å

PDB Description: m. smegmatis arylamine n-acetyl transferase

SCOP Domain Sequences for d1gx3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gx3d_ d.3.1.5 (D:) Arylamine N-acetyltransferase {Mycobacterium smegmatis}
amdlggyltrigldgrprpdlgtlhaivaahnrsipfenldpllgipvadlsaealfakl
vdrrrggycyehngllgyvleelgfeverlsgrvvwmraddaplpaqthnvlsvavpgad
grylvdvgfggqtltspirleagpvqqtrhepyrltrhgddhtlaaqvrgewqplytftt
eprpridlevgswyvsthpgshfvtgltvavvtddarynlrgrnlavhrsgatehirfds
aaqvldaivnrfgidlgdlagrdvqarvaevldt

SCOP Domain Coordinates for d1gx3d_:

Click to download the PDB-style file with coordinates for d1gx3d_.
(The format of our PDB-style files is described here.)

Timeline for d1gx3d_: