Lineage for d1gx3c_ (1gx3 C:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 715176Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 715177Superfamily d.3.1: Cysteine proteinases [54001] (16 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 715528Family d.3.1.5: Arylamine N-acetyltransferase [54047] (1 protein)
    fold similar to that of the factor XIII catalytic domain
  6. 715529Protein Arylamine N-acetyltransferase [54048] (4 species)
  7. 715530Species Mycobacterium smegmatis [TaxId:1772] [75335] (3 PDB entries)
  8. 715535Domain d1gx3c_: 1gx3 C: [70680]

Details for d1gx3c_

PDB Entry: 1gx3 (more details), 1.7 Å

PDB Description: m. smegmatis arylamine n-acetyl transferase
PDB Compounds: (C:) arylamine n-acetyltransferase

SCOP Domain Sequences for d1gx3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gx3c_ d.3.1.5 (C:) Arylamine N-acetyltransferase {Mycobacterium smegmatis [TaxId: 1772]}
amdlggyltrigldgrprpdlgtlhaivaahnrsipfenldpllgipvadlsaealfakl
vdrrrggycyehngllgyvleelgfeverlsgrvvwmraddaplpaqthnvlsvavpgad
grylvdvgfggqtltspirleagpvqqtrhepyrltrhgddhtlaaqvrgewqplytftt
eprpridlevgswyvsthpgshfvtgltvavvtddarynlrgrnlavhrsgatehirfds
aaqvldaivnrfgidlgdlagrdvqarvaevldt

SCOP Domain Coordinates for d1gx3c_:

Click to download the PDB-style file with coordinates for d1gx3c_.
(The format of our PDB-style files is described here.)

Timeline for d1gx3c_: