Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 proteins) fold similar to that of the factor XIII catalytic domain automatically mapped to Pfam PF00797 |
Protein Arylamine N-acetyltransferase [54048] (4 species) |
Species Mycobacterium smegmatis [TaxId:1772] [75335] (3 PDB entries) |
Domain d1gx3c_: 1gx3 C: [70680] |
PDB Entry: 1gx3 (more details), 1.7 Å
SCOPe Domain Sequences for d1gx3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gx3c_ d.3.1.5 (C:) Arylamine N-acetyltransferase {Mycobacterium smegmatis [TaxId: 1772]} amdlggyltrigldgrprpdlgtlhaivaahnrsipfenldpllgipvadlsaealfakl vdrrrggycyehngllgyvleelgfeverlsgrvvwmraddaplpaqthnvlsvavpgad grylvdvgfggqtltspirleagpvqqtrhepyrltrhgddhtlaaqvrgewqplytftt eprpridlevgswyvsthpgshfvtgltvavvtddarynlrgrnlavhrsgatehirfds aaqvldaivnrfgidlgdlagrdvqarvaevldt
Timeline for d1gx3c_: