SCOP 1.63: Domain d1gx3a_: 1gx3 A:

Lineage for d1gx3a_ (1gx3 A:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (9 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.5: Arylamine N-acetyltransferase [54047] (1 protein)
   fold similar to that of the factor XIII catalytic domain

6. Protein Arylamine N-acetyltransferase [54048] (2 species)

7. Species Mycobacterium smegmatis [TaxId:1772] [75335] (1 PDB entry)

8. Domain d1gx3a_: 1gx3 A: [70678]

Details for d1gx3a_

PDB Entry: 1gx3, 1.7 Å

PDB Description: m. smegmatis arylamine n-acetyl transferase

SCOP Domain Sequences for d1gx3a_:

Sequence; same for both SEQRES and ATOM records:

>d1gx3a_ d.3.1.5 (A:) Arylamine N-acetyltransferase {Mycobacterium smegmatis}
gmamdlggyltrigldgrprpdlgtlhaivaahnrsipfenldpllgipvadlsaealfa
klvdrrrggycyehngllgyvleelgfeverlsgrvvwmraddaplpaqthnvlsvavpg
adgrylvdvgfggqtltspirleagpvqqtrhepyrltrhgddhtlaaqvrgewqplytf
tteprpridlevgswyvsthpgshfvtgltvavvtddarynlrgrnlavhrsgatehirf
dsaaqvldaivnrfgidlgdlagrdvqarvaevldt

Timeline for d1gx3a_:

• d1gx3a_ first appeared in SCOP 1.61
  
• d1gx3a_ appears in SCOP 1.65
  
• d1gx3a_ appears in the current release, SCOPe 2.08