Lineage for d1gx1c1 (1gx1 C:1-156)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2202094Superfamily d.79.5: IpsF-like [69765] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2202095Family d.79.5.1: IpsF-like [69766] (3 proteins)
    automatically mapped to Pfam PF02542
  6. 2202096Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species)
  7. 2202110Species Escherichia coli [TaxId:562] [69768] (14 PDB entries)
    Uniprot P62617 ! Uniprot P36663
  8. 2202113Domain d1gx1c1: 1gx1 C:1-156 [70677]
    Other proteins in same PDB: d1gx1a2, d1gx1b2, d1gx1c2
    complexed with cdp, mn, so4, zn

Details for d1gx1c1

PDB Entry: 1gx1 (more details), 1.8 Å

PDB Description: structure of 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase
PDB Compounds: (C:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d1gx1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gx1c1 d.79.5.1 (C:1-156) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli [TaxId: 562]}
mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
gchmddvnvkattteklgftgrgegiaceavallik

SCOPe Domain Coordinates for d1gx1c1:

Click to download the PDB-style file with coordinates for d1gx1c1.
(The format of our PDB-style files is described here.)

Timeline for d1gx1c1: