Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.5: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69765] (1 family) forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.5.1: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69766] (1 protein) |
Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (3 species) |
Species Escherichia coli [TaxId:562] [69768] (8 PDB entries) |
Domain d1gx1a_: 1gx1 A: [70675] |
PDB Entry: 1gx1 (more details), 1.8 Å
SCOP Domain Sequences for d1gx1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gx1a_ d.79.5.1 (A:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli} emrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigk lfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaed lgchmddvnvkattteklgftgrgegiaceavallik
Timeline for d1gx1a_: