Lineage for d1gwja_ (1gwj A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2414849Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2414850Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2415150Protein Morphinone reductase [75053] (1 species)
  7. 2415151Species Pseudomonas putida [TaxId:303] [75054] (3 PDB entries)
  8. 2415153Domain d1gwja_: 1gwj A: [70671]
    complexed with fmn

Details for d1gwja_

PDB Entry: 1gwj (more details), 2.2 Å

PDB Description: morphinone reductase
PDB Compounds: (A:) morphinone reductase

SCOPe Domain Sequences for d1gwja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]}
tsfsnpglftplqlgslslpnrvimapltrsrtpdsvpgrlqqiyygqrasagliiseat
nisptargyvytpgiwtdaqeagwkgvveavhakggrialqlwhvgrvshelvqpdgqqp
vapsalkaegaecfvefedgtaglhptstpraletdgipgivedyrqaaqrakragfdmv
evhaanaclpnqflatgtnrrtdqyggsienrarfplevvdavaevfgpervgirltpfl
elfgltddepeamafylageldrrglaylhfnepdwiggditypegfreqmrqrfkggli
ycgnydagraqarlddntadavafgrpfianpdlperfrlgaalnepdpstfyggaevgy
tdypfldnghdrlg

SCOPe Domain Coordinates for d1gwja_:

Click to download the PDB-style file with coordinates for d1gwja_.
(The format of our PDB-style files is described here.)

Timeline for d1gwja_: