Lineage for d1gwcc2 (1gwc C:4-86)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2132062Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2132603Protein Class tau GST [81365] (2 species)
  7. 2132604Species Aegilops tauschii, also known as Triticum tauschii [TaxId:37682] [75236] (1 PDB entry)
  8. 2132607Domain d1gwcc2: 1gwc C:4-86 [70665]
    Other proteins in same PDB: d1gwca1, d1gwcb1, d1gwcc1
    complexed with gtx, so4

Details for d1gwcc2

PDB Entry: 1gwc (more details), 2.25 Å

PDB Description: the structure of a tau class glutathione s-transferase from wheat, active in herbicide detoxification
PDB Compounds: (C:) glutathione s-transferase tsi-1

SCOPe Domain Sequences for d1gwcc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gwcc2 c.47.1.5 (C:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]}
gddlkllgawpspfvtrvklalalkglsyedveedlykkselllksnpvhkkipvlihng
apvcesmiilqyidevfastgps

SCOPe Domain Coordinates for d1gwcc2:

Click to download the PDB-style file with coordinates for d1gwcc2.
(The format of our PDB-style files is described here.)

Timeline for d1gwcc2: