Lineage for d1gwca2 (1gwc A:4-86)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1368661Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1369206Protein Class tau GST [81365] (2 species)
  7. 1369207Species Aegilops tauschii, also known as Triticum tauschii [TaxId:37682] [75236] (1 PDB entry)
  8. 1369208Domain d1gwca2: 1gwc A:4-86 [70661]
    Other proteins in same PDB: d1gwca1, d1gwcb1, d1gwcc1
    complexed with gtx, so4

Details for d1gwca2

PDB Entry: 1gwc (more details), 2.25 Å

PDB Description: the structure of a tau class glutathione s-transferase from wheat, active in herbicide detoxification
PDB Compounds: (A:) glutathione s-transferase tsi-1

SCOPe Domain Sequences for d1gwca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]}
gddlkllgawpspfvtrvklalalkglsyedveedlykkselllksnpvhkkipvlihng
apvcesmiilqyidevfastgps

SCOPe Domain Coordinates for d1gwca2:

Click to download the PDB-style file with coordinates for d1gwca2.
(The format of our PDB-style files is described here.)

Timeline for d1gwca2: