Lineage for d1gw9a_ (1gw9 A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 174604Superfamily c.1.15: Xylose isomerase-like [51658] (5 families) (S)
  5. 174625Family c.1.15.3: Xylose isomerase [51665] (1 protein)
  6. 174626Protein D-xylose isomerase [51666] (12 species)
  7. 174751Species Streptomyces rubiginosus [TaxId:1929] [51670] (16 PDB entries)
  8. 174754Domain d1gw9a_: 1gw9 A: [70658]

Details for d1gw9a_

PDB Entry: 1gw9 (more details), 1.55 Å

PDB Description: tri-iodide derivative of xylose isomerase from streptomyces rubiginosus

SCOP Domain Sequences for d1gw9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gw9a_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces rubiginosus}
nyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvqrlaelgahgvtfhdddlipf
gssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktir
nidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaie
pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl
fhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwa
saagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefd
vdaaaargmaferldqlamdhllga

SCOP Domain Coordinates for d1gw9a_:

Click to download the PDB-style file with coordinates for d1gw9a_.
(The format of our PDB-style files is described here.)

Timeline for d1gw9a_: